Skip to content
  • Reliable.Affordable.Accessible.
  • Reliable.Affordable.Accessible.
besttpharma.combesttpharma.com
  • HOME
  • Shop
    • Weight Loss Medication
    • Supplements
    • Pain Relief
    • Nerve Pain
    • Men’s Health
    • Insomnia & Sleep Medication
    • Insomnia & Sleep Medication
    • Anxiety
    • ADHD & Focus
    • Blood Thinners
    • Cancer Treatment
    • Digestive Health
    • Heart & Blood Pressure
  • About Us
  • CONTACT US
  • Medical Disclaimer
  • Privacy Policy
  • Terms and Conditions
  • Blog
  • Cart / $0.00 0
    • No products in the cart.

      Return to shop

  • 0
    Cart

    No products in the cart.

    Return to shop

Add to wishlist
TB-500 10mg
Home / Weight Loss Medication / peptides

TB-500 10mg

$45.00

Category: peptides Tags: aod 9604 peptide for sale​, ara 290 peptide for sale​, bachem peptides for sale​, bpc 157 peptide for sale​, bpc 157 peptides for sale​, ghk-cu peptide for sale​, glow peptide for sale​, glp3 peptide for sale​, hcg peptides for sale​, hgh peptides for sale​, ipamorelin peptide for sale​, klow peptide for sale​, ll-37 peptide for sale​, mots-c peptide for sale​, peptides for sale near me​, pt 141 peptide for sale​, semax peptide for sale​, slu-pp-332 peptide for sale​, ss 31 peptide for sale​, tb 500 peptide for sale​, tirzepatide research peptide for sale​
  • Description
  • Reviews (0)
    • TB-500 10mg

 

  • Additional information

Description

 

TB-500, also known as Thymosin Beta-4, is a naturally occurring 43-amino-acid peptide studied for its role in wound healing, angiogenesis, and tissue regeneration. It supports cellular migration and structural repair through its interactions with actin, a key protein in cell movement and organization.

Benefits

  • Wound healing — studied for promoting faster tissue recovery and repair.
  • Angiogenesis — linked to formation of new blood vessels in healing tissue.
  • Cell migration — supports actin-binding and cytoskeletal reorganization.
  • Inflammation control — explored for balancing inflammatory and repair responses.
  • Tissue resilience — interest in regeneration of skin, muscle, tendon, and heart tissue.

What researchers look at

  • Mechanism: actin-sequestering peptide influencing cell motility and repair.
  • Preclinical studies in corneal, cardiac, and dermal wound healing models.
  • Angiogenesis pathways involving VEGF and integrin expression.
  • Exploration for systemic and localized regenerative applications.

Quick Specs

  • Form: Lyophilized peptide
  • Net per vial: 10 mg
  • Purity: ≥99% (HPLC)
  • Identity: MS-verified (per COA)
  • Storage: 2–8 °C, protect from light

Identity Basics

  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
  • Formula / M.W.: C212H350N56O78S, ~4963 g/mol
  • CAS: 77591-33-4

Reviews

There are no reviews yet.

Be the first to review “TB-500 10mg” Cancel reply

Related products

NAD+ 100mg-NAD+ Injection
Add to wishlist
Quick View

peptides

NAD+ 100mg-NAD+ Injection

$64.00
HMG 1.5mg
Add to wishlist
Quick View

peptides

HMG 1.5mg

$55.00
SIXPEX Ipamorelin 5mg US
Add to wishlist
Quick View

peptides

SIXPEX Ipamorelin 5mg US

$50.00
Ultima-GHRP-6 5mg US
Add to wishlist
Quick View

peptides

Ultima-GHRP-6 5mg US

$48.00
Driada MOTS-C 10 mg
Add to wishlist
Quick View

peptides

Driada MOTS-C 10 mg

$62.00
Tirzepatide 10mg/mL ( 4weeks cycle )
Add to wishlist
Quick View

peptides

Tirzepatide 10mg/mL ( 4weeks cycle )

$215.00
Retatrutide – 10mg
Add to wishlist
Quick View

peptides

Retatrutide – 10mg

$80.00
Sermorelin 5mg- sermorelin peptide
Add to wishlist
Quick View

peptides

Sermorelin 5mg- sermorelin peptide

$55.00
Latest
  • Oxycodone 15MG Oxycodone 15MG $130.00
  • XANAX BARS 2MG XANAX BARS 2MG $100.00
  • SIXPEX Semaglutide 5mg SIXPEX Semaglutide 5mg
  • Hubio Melanotan 2 10mg Hubio Melanotan 2 10mg $45.00
Best Selling
  • online pharmacy Buy Codeine Online $194.72 – $421.90Price range: $194.72 through $421.90
  • Retatrutide – 10mg Retatrutide – 10mg $80.00
  • Bacteriostatic Water Bacteriostatic Water $10.00
  • buy drugs Online Buy Dilaudid Online $140.63 – $378.63Price range: $140.63 through $378.63
Top Rated
  • online pharmacy Buy Codeine Online $194.72 – $421.90Price range: $194.72 through $421.90
  • Hubio IGF-1 LR3 1mg Hubio IGF-1 LR3 1mg $100.00
  • Ultima-IGF-1 LR3 1mg US Ultima-IGF-1 LR3 1mg US $150.00
About us

Best Pharma is a top online pharmacy, and we focus on providing the magic pill for your ill. We are one of the most reliable and popular online pharmacies in the nation who have experience in the pharmaceutical industry for a significant number of years.

Latest News
  • 21
    Nov
    Order Ambien Online Safely—7 Things You Must Know Before Buying
  • 21
    Nov
    Order Adderall online safely- 7 things you must know before buying.
  • 28
    Oct
    Order Ozempic Online – 7 Important Things to Know Before You Buy
  • 28
    Oct
    Order Dilaudid Online – 7 Things You Need to Know Before Buying
Tags
aod9604 peptide for sale​ aod 9604 peptide for sale​ ara 290 peptide for sale​ asymchem peptides for sale​ bam15 peptide for sale​ bpc 157 peptide for sale​ bpc 157 peptides for sale​ cagrilintide peptide for sale​ ghk-cu peptide for sale​ glp-1 peptide for sale​ glp 1 peptides for sale​ glp3 peptide for sale​ gonadorelin peptide for sale​ hgh peptides for sale​ igf-1 peptide for sale​ injectable peptides for sale​ ipamorelin peptide for sale​ klow blend peptide for sale​ klow peptide for sale​ lipo-c peptide for sale​ ll-37 peptide for sale​ ll37 peptide for sale​ manp peptide for sale​ mot c peptide for sale​ mots-c peptide for sale​ mt2 peptide for sale​ oral peptides for sale​ peptide bpc 157 for sale​ peptide pens for sale​ peptide retatrutide for sale​ peptides bpc-157 for sale​ peptides for sale online​ peptide tirzepatide for sale​ pt-141 peptide for sale amazon​ pt 141 peptide for sale amazon review​ pt 141 peptide for sale​ retatrutide peptide for sale online​ semax peptide for sale​ slu-pp-332 peptide for sale​ ss 31 peptide for sale​ ss31 peptide for sale​ tb 500 peptide for sale​ tb500 peptide for sale​ tirzepatide peptides for sale​ tirzepatide research peptide for sale​
Signup for Newsletter

info@besttpharma.com

  • HOME
  • Shop
  • About Us
  • CONTACT US
  • Medical Disclaimer
  • Privacy Policy
  • Terms and Conditions
  • Blog
Copyright 2026 © BEST PHARMA
  • HOME
  • Shop
    • Weight Loss Medication
    • Supplements
    • Pain Relief
    • Nerve Pain
    • Men’s Health
    • Insomnia & Sleep Medication
    • Insomnia & Sleep Medication
    • Anxiety
    • ADHD & Focus
    • Blood Thinners
    • Cancer Treatment
    • Digestive Health
    • Heart & Blood Pressure
  • About Us
  • CONTACT US
  • Medical Disclaimer
  • Privacy Policy
  • Terms and Conditions
  • Blog

Login

Lost your password?

WhatsApp us