TB-500 10mg

TB-500, also known as Thymosin Beta-4, is a naturally occurring 43-amino-acid peptide studied for its role in wound healing, angiogenesis, and tissue regeneration. It supports cellular migration and structural repair through its interactions with actin, a key protein in cell movement and organization.

Benefits

• Wound healing — studied for promoting faster tissue recovery and repair.
• Angiogenesis — linked to formation of new blood vessels in healing tissue.
• Cell migration — supports actin-binding and cytoskeletal reorganization.
• Inflammation control — explored for balancing inflammatory and repair responses.
• Tissue resilience — interest in regeneration of skin, muscle, tendon, and heart tissue.

What researchers look at

• Mechanism: actin-sequestering peptide influencing cell motility and repair.
• Preclinical studies in corneal, cardiac, and dermal wound healing models.
• Angiogenesis pathways involving VEGF and integrin expression.
• Exploration for systemic and localized regenerative applications.

Quick Specs

• Form: Lyophilized peptide
• Net per vial: 10 mg
• Purity: ≥99% (HPLC)
• Identity: MS-verified (per COA)
• Storage: 2–8 °C, protect from light

Identity Basics

• Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
• Formula / M.W.: C212H350N56O78S, ~4963 g/mol
• CAS: 77591-33-4